Recombinant Full Length Human ERAS Protein, GST-tagged
| Cat.No. : | ERAS-4357HF |
| Product Overview : | Human ERAS full-length ORF ( NP_853510.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 233 amino acids |
| Description : | This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012] |
| Molecular Mass : | 51.70 kDa |
| AA Sequence : | MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ERAS ES cell expressed Ras [ Homo sapiens ] |
| Official Symbol | ERAS |
| Synonyms | ERAS; ES cell expressed Ras; HRAS2, HRASP, v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene; GTPase ERas; E-Ras; small GTPase protein E-Ras; embryonic stem cell-expressed Ras; v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2; v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene; HRAS2; HRASP; MGC126691; MGC126693; |
| Gene ID | 3266 |
| mRNA Refseq | NM_181532 |
| Protein Refseq | NP_853510 |
| MIM | 300437 |
| UniProt ID | Q7Z444 |
| ◆ Recombinant Proteins | ||
| ERAS-1261H | Recombinant Human ERAS Protein (3-230 aa), His-tagged | +Inquiry |
| ERAS-716HFL | Recombinant Full Length Human ERAS Protein, C-Flag-tagged | +Inquiry |
| ERAS-4357HF | Recombinant Full Length Human ERAS Protein, GST-tagged | +Inquiry |
| Eras-2852M | Recombinant Mouse Eras Protein, Myc/DDK-tagged | +Inquiry |
| ERAS-1315R | Recombinant Rhesus Macaque ERAS Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ERAS-6570HCL | Recombinant Human ERAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERAS Products
Required fields are marked with *
My Review for All ERAS Products
Required fields are marked with *
