Recombinant Full Length Human ERAS Protein, GST-tagged

• Cat.No.: ERAS-4357HF
• Product Overview: Human ERAS full-length ORF ( NP_853510.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 233 amino acids
• Description: This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012]
• Molecular Mass: 51.70 kDa
• AA Sequence: MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERAS ES cell expressed Ras [ Homo sapiens ]
• Official Symbol: ERAS
• Synonyms: ERAS; ES cell expressed Ras; HRAS2, HRASP, v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene; GTPase ERas; E-Ras; small GTPase protein E-Ras; embryonic stem cell-expressed Ras; v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2; v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene; HRAS2; HRASP; MGC126691; MGC126693
• Gene ID: 3266
• mRNA Refseq: NM_181532
• Protein Refseq: NP_853510
• MIM: 300437
• UniProt ID: Q7Z444