Recombinant Human ERCC4 protein, His-tagged

• Cat.No.: ERCC4-3826H
• Product Overview: Recombinant Human ERCC4 protein(658-753 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 658-753 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: RGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ERCC4 excision repair cross-complementing rodent repair deficiency, complementation group 4 [ Homo sapiens ]
• Official Symbol: ERCC4
• Synonyms: ERCC4; excision repair cross-complementing rodent repair deficiency, complementation group 4; XPF; DNA repair endonuclease XPF; RAD1; xeroderma pigmentosum; complementation group F; DNA excision repair protein ERCC-4; DNA repair protein complementing XP-F cells; xeroderma pigmentosum, complementation group F; xeroderma pigmentosum group F-complementing protein; excision-repair, complementing defective, in Chinese hamster; ERCC11
• Gene ID: 2072
• mRNA Refseq: NM_005236
• Protein Refseq: NP_005227
• MIM: 133520
• UniProt ID: Q92889