Recombinant Human ERCC4 protein, His-tagged
Cat.No. : | ERCC4-3826H |
Product Overview : | Recombinant Human ERCC4 protein(658-753 aa), fused to His tag, was expressed in E. coli. |
Availability | August 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 658-753 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ERCC4 excision repair cross-complementing rodent repair deficiency, complementation group 4 [ Homo sapiens ] |
Official Symbol | ERCC4 |
Synonyms | ERCC4; excision repair cross-complementing rodent repair deficiency, complementation group 4; XPF; DNA repair endonuclease XPF; RAD1; xeroderma pigmentosum; complementation group F; DNA excision repair protein ERCC-4; DNA repair protein complementing XP-F cells; xeroderma pigmentosum, complementation group F; xeroderma pigmentosum group F-complementing protein; excision-repair, complementing defective, in Chinese hamster; ERCC11; |
Gene ID | 2072 |
mRNA Refseq | NM_005236 |
Protein Refseq | NP_005227 |
MIM | 133520 |
UniProt ID | Q92889 |
◆ Recombinant Proteins | ||
ERCC4-1928HFL | Recombinant Full Length Human ERCC4 Protein, C-Flag-tagged | +Inquiry |
ERCC4-5573H | Recombinant Human ERCC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERCC4-861H | Recombinant Human ERCC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERCC4-3826H | Recombinant Human ERCC4 protein, His-tagged | +Inquiry |
ERCC4-10173Z | Recombinant Zebrafish ERCC4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERCC4-6564HCL | Recombinant Human ERCC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERCC4 Products
Required fields are marked with *
My Review for All ERCC4 Products
Required fields are marked with *