Recombinant Human ERG protein, T7/His-tagged

Cat.No. : ERG-210H
Product Overview : Recombinant human ERG cDNA (479aa, Isoform-I, which derived from BC040168) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 497 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGSASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSP RVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERR VIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETP LPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQ PSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVAR RWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAH PQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYYLEESGGGGSPGRRRRRRRRR RR
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ERG v-ets erythroblastosis virus E26 oncogene homolog (avian) [ Homo sapiens ]
Official Symbol ERG
Synonyms ERG; v-ets erythroblastosis virus E26 oncogene homolog (avian); v ets avian erythroblastosis virus E26 oncogene related , v ets erythroblastosis virus E26 oncogene like (avian); transcriptional regulator ERG; erg 3; p55; TMPRSS2 ERG prostate cancer specific; transcriptional regulator ERG (transforming protein ERG); v ets avian erythroblastosis virus E26 oncogene related; v ets erythroblastosis virus E26 oncogene like; ets-related; TMPRSS2/ERG fusion; v-ets erythroblastosis virus E26 oncogene like; v-ets avian erythroblastosis virus E26 oncogene related; erg-3;
Gene ID 2078
mRNA Refseq NM_001136154
Protein Refseq NP_001129626
MIM 165080
UniProt ID P11308
Chromosome Location 21q22.3
Pathway Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;
Function DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERG Products

Required fields are marked with *

My Review for All ERG Products

Required fields are marked with *

0
cart-icon