Recombinant Human ERG protein, T7/His-tagged
Cat.No. : | ERG-210H |
Product Overview : | Recombinant human ERG cDNA (479aa, Isoform-I, which derived from BC040168) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 497 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGSASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSP RVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERR VIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETP LPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQ PSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVAR RWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAH PQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYYLEESGGGGSPGRRRRRRRRR RR |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ERG v-ets erythroblastosis virus E26 oncogene homolog (avian) [ Homo sapiens ] |
Official Symbol | ERG |
Synonyms | ERG; v-ets erythroblastosis virus E26 oncogene homolog (avian); v ets avian erythroblastosis virus E26 oncogene related , v ets erythroblastosis virus E26 oncogene like (avian); transcriptional regulator ERG; erg 3; p55; TMPRSS2 ERG prostate cancer specific; transcriptional regulator ERG (transforming protein ERG); v ets avian erythroblastosis virus E26 oncogene related; v ets erythroblastosis virus E26 oncogene like; ets-related; TMPRSS2/ERG fusion; v-ets erythroblastosis virus E26 oncogene like; v-ets avian erythroblastosis virus E26 oncogene related; erg-3; |
Gene ID | 2078 |
mRNA Refseq | NM_001136154 |
Protein Refseq | NP_001129626 |
MIM | 165080 |
UniProt ID | P11308 |
Chromosome Location | 21q22.3 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
ERG-1906Z | Recombinant Zebrafish ERG | +Inquiry |
ERG-863H | Recombinant Human ERG Protein, His (Fc)-Avi-tagged | +Inquiry |
ERG-37HFL | Active Recombinant Full Length Human ERG Protein, C-Flag-tagged | +Inquiry |
Erg-973M | Recombinant Mouse Erg Protein, MYC/DDK-tagged | +Inquiry |
ERG-8433H | Recombinant Human ERG protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERG-6560HCL | Recombinant Human ERG 293 Cell Lysate | +Inquiry |
ERG-6559HCL | Recombinant Human ERG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERG Products
Required fields are marked with *
My Review for All ERG Products
Required fields are marked with *
0
Inquiry Basket