Recombinant Human ERG protein, T7/His-tagged

• Cat.No.: ERG-210H
• Product Overview: Recombinant human ERG cDNA (479aa, Isoform-I, which derived from BC040168) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 497 a.a.
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGSASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSP RVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERR VIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETP LPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQ PSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVAR RWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAH PQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYYLEESGGGGSPGRRRRRRRRR RR
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: ERG v-ets erythroblastosis virus E26 oncogene homolog (avian) [ Homo sapiens ]
• Official Symbol: ERG
• Synonyms: ERG; v-ets erythroblastosis virus E26 oncogene homolog (avian); v ets avian erythroblastosis virus E26 oncogene related , v ets erythroblastosis virus E26 oncogene like (avian); transcriptional regulator ERG; erg 3; p55; TMPRSS2 ERG prostate cancer specific; transcriptional regulator ERG (transforming protein ERG); v ets avian erythroblastosis virus E26 oncogene related; v ets erythroblastosis virus E26 oncogene like; ets-related; TMPRSS2/ERG fusion; v-ets erythroblastosis virus E26 oncogene like; v-ets avian erythroblastosis virus E26 oncogene related; erg-3
• Gene ID: 2078
• mRNA Refseq: NM_001136154
• Protein Refseq: NP_001129626
• MIM: 165080
• UniProt ID: P11308
• Chromosome Location: 21q22.3
• Pathway: Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem
• Function: DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity