Recombinant Full Length Human ERMAP Protein, C-Flag-tagged
Cat.No. : | ERMAP-1867HFL |
Product Overview : | Recombinant Full Length Human ERMAP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPF PQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVI LQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHK AVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVV SILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFR LKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE SIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | ERMAP erythroblast membrane associated protein (Scianna blood group) [ Homo sapiens (human) ] |
Official Symbol | ERMAP |
Synonyms | RD; SC; BTN5; PRO2801 |
Gene ID | 114625 |
mRNA Refseq | NM_001017922.2 |
Protein Refseq | NP_001017922.1 |
MIM | 609017 |
UniProt ID | Q96PL5 |
◆ Recombinant Proteins | ||
ERMAP-1867HFL | Recombinant Full Length Human ERMAP Protein, C-Flag-tagged | +Inquiry |
ERMAP-864H | Recombinant Human ERMAP Protein, His (Fc)-Avi-tagged | +Inquiry |
ERMAP-7771H | Recombinant Human ERMAP, His-tagged | +Inquiry |
ERMAP-4594HF | Recombinant Full Length Human ERMAP Protein, GST-tagged | +Inquiry |
Ermap-2862M | Recombinant Mouse Ermap Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERMAP-6549HCL | Recombinant Human ERMAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERMAP Products
Required fields are marked with *
My Review for All ERMAP Products
Required fields are marked with *
0
Inquiry Basket