Recombinant Human ERMP1 Protein, GST-tagged
Cat.No. : | ERMP1-3482H |
Product Overview : | Human ERMP1 full-length ORF ( AAH31630.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ERMP1 (Endoplasmic Reticulum Metallopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and metallopeptidase activity. |
Molecular Mass : | 62.4 kDa |
AA Sequence : | MFIPYLYALYLIWAVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKKTMLTLTLVCAITFLLVCSGTFFPYSSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQASAWQFWIEVQVSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERMP1 endoplasmic reticulum metallopeptidase 1 [ Homo sapiens ] |
Official Symbol | ERMP1 |
Synonyms | endoplasmic reticulum metallopeptidase 1; 23703; Ensembl:ENSG00000099219; KIAA1815; endoplasmic reticulum metallopeptidase 1;Felix-ina;aminopeptidase Fxna;bA207C16.3 (novel protein similar to predicted yeast, plant and worm proteins); FXNA; KIAA1815; bA207C16.3 |
Gene ID | 79956 |
mRNA Refseq | NM_024896 |
Protein Refseq | NP_079172 |
MIM | 611156 |
UniProt ID | B3KSB1 |
◆ Recombinant Proteins | ||
ERMP1-1799R | Recombinant Rat ERMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERMP1-2856M | Recombinant Mouse ERMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERMP1-5309M | Recombinant Mouse ERMP1 Protein | +Inquiry |
ERMP1-7432H | Recombinant Human ERMP1 protein, His-tagged | +Inquiry |
ERMP1-12542H | Recombinant Human ERMP1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERMP1 Products
Required fields are marked with *
My Review for All ERMP1 Products
Required fields are marked with *