Recombinant Human ERMP1 Protein, GST-tagged

Cat.No. : ERMP1-3482H
Product Overview : Human ERMP1 full-length ORF ( AAH31630.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ERMP1 (Endoplasmic Reticulum Metallopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and metallopeptidase activity.
Molecular Mass : 62.4 kDa
AA Sequence : MFIPYLYALYLIWAVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKKTMLTLTLVCAITFLLVCSGTFFPYSSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQASAWQFWIEVQVSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERMP1 endoplasmic reticulum metallopeptidase 1 [ Homo sapiens ]
Official Symbol ERMP1
Synonyms endoplasmic reticulum metallopeptidase 1; 23703; Ensembl:ENSG00000099219; KIAA1815; endoplasmic reticulum metallopeptidase 1;Felix-ina;aminopeptidase Fxna;bA207C16.3 (novel protein similar to predicted yeast, plant and worm proteins); FXNA; KIAA1815; bA207C16.3
Gene ID 79956
mRNA Refseq NM_024896
Protein Refseq NP_079172
MIM 611156
UniProt ID B3KSB1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERMP1 Products

Required fields are marked with *

My Review for All ERMP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon