Recombinant Human ERMP1 protein, His-tagged
| Cat.No. : | ERMP1-7432H |
| Product Overview : | Recombinant Human ERMP1 protein(Q7Z2K6)(85-399aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 85-399a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | RTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEALHHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATSDMLAAASKYRHGNM |
| Gene Name | ERMP1 endoplasmic reticulum metallopeptidase 1 [ Homo sapiens ] |
| Official Symbol | ERMP1 |
| Synonyms | endoplasmic reticulum metallopeptidase 1; 23703; Ensembl:ENSG00000099219; KIAA1815; endoplasmic reticulum metallopeptidase 1;Felix-ina;aminopeptidase Fxna;bA207C16.3 (novel protein similar to predicted yeast, plant and worm proteins); FXNA; KIAA1815; bA207C16.3 |
| Gene ID | 79956 |
| mRNA Refseq | NM_024896.2 |
| Protein Refseq | NP_079172.2 |
| MIM | 611156 |
| UniProt ID | B3KSB1 |
| ◆ Recombinant Proteins | ||
| ERMP1-2856M | Recombinant Mouse ERMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ERMP1-5309M | Recombinant Mouse ERMP1 Protein | +Inquiry |
| ERMP1-2142R | Recombinant Rat ERMP1 Protein | +Inquiry |
| ERMP1-3482H | Recombinant Human ERMP1 Protein, GST-tagged | +Inquiry |
| ERMP1-4596HF | Recombinant Full Length Human ERMP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERMP1 Products
Required fields are marked with *
My Review for All ERMP1 Products
Required fields are marked with *
