Recombinant Human ESM1 Protein (20-184aa), C-His tagged

• Cat.No.: ESM1-04H
• Product Overview: Recombinant human ESM1 (20-184aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 20-184aa
• Description: This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid
• Molecular Mass: 19.2 kDa (174aa)
• AA Sequence: ADLWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRHHHHHH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
• Official Symbol: ESM1
• Synonyms: ESM1; endothelial cell-specific molecule 1; ESM-1; endocan
• Gene ID: 11082
• mRNA Refseq: NM_007036
• Protein Refseq: NP_008967
• MIM: 601521
• UniProt ID: Q9NQ30