Recombinant Human ESM1 Protein (20-184aa), C-His tagged

Cat.No. : ESM1-04H
Product Overview : Recombinant human ESM1 (20-184aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 20-184aa
Description : This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : 19.2 kDa (174aa)
AA Sequence : ADLWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
Official Symbol ESM1
Synonyms ESM1; endothelial cell-specific molecule 1; ESM-1; endocan;
Gene ID 11082
mRNA Refseq NM_007036
Protein Refseq NP_008967
MIM 601521
UniProt ID Q9NQ30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ESM1 Products

Required fields are marked with *

My Review for All ESM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon