Recombinant Human ESM1 Protein, His-tagged

• Cat.No.: ESM1-456H
• Product Overview: Recombinant Human ESM1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: THis gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of tHis gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for tHis gene.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Molecular Mass: 19.16kD
• AA Sequence: WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
• Official Symbol: ESM1
• Synonyms: ESM1; endothelial cell-specific molecule 1; ESM-1; endocan
• Gene ID: 11082
• mRNA Refseq: NM_001135604
• Protein Refseq: NP_001129076
• MIM: 601521
• UniProt ID: Q9NQ30