Recombinant Human ESM1 Protein, His-tagged
Cat.No. : | ESM1-456H |
Product Overview : | Recombinant Human ESM1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | THis gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of tHis gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for tHis gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Molecular Mass : | 19.16kD |
AA Sequence : | WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ] |
Official Symbol | ESM1 |
Synonyms | ESM1; endothelial cell-specific molecule 1; ESM-1; endocan; |
Gene ID | 11082 |
mRNA Refseq | NM_001135604 |
Protein Refseq | NP_001129076 |
MIM | 601521 |
UniProt ID | Q9NQ30 |
◆ Recombinant Proteins | ||
ESM1-1806R | Recombinant Rat ESM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESM1-04H | Recombinant Human ESM1 Protein (20-184aa), C-His tagged | +Inquiry |
ESM1-2149R | Recombinant Rat ESM1 Protein | +Inquiry |
ESM1-902H | Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged | +Inquiry |
ESM1-7082H | Recombinant Human ESM1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESM1 Products
Required fields are marked with *
My Review for All ESM1 Products
Required fields are marked with *