| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Description : |
THis gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of tHis gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for tHis gene. |
| Form : |
Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Molecular Mass : |
19.16kD |
| AA Sequence : |
WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRVDHHHHHH |
| Endotoxin : |
Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : |
>95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |