Recombinant Human ETHE1, His-tagged
| Cat.No. : | ETHE1-28406TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 23-239 of Human ETHE1 with an N terminal His tag. Observed mwt: 25 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-239 a.a. |
| Description : | This gene encodes a sulfur dioxygenase that localizes within the mitochondrial matrix. The enzyme functions in sulfide catabolism. Mutations in this gene result in ethylmalonic encephalopathy. |
| Conjugation : | HIS |
| Tissue specificity : | Ubiquitously expressed. |
| Form : | Lyophilised:Reconstitute with 117 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDA QLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQS VISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSV HEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLT LSCEEFVKIMGNLNLPKPQQIDF |
| Sequence Similarities : | Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family. |
| Gene Name | ETHE1 ethylmalonic encephalopathy 1 [ Homo sapiens ] |
| Official Symbol | ETHE1 |
| Synonyms | ETHE1; ethylmalonic encephalopathy 1; protein ETHE1, mitochondrial; HSCO; YF13H12; |
| Gene ID | 23474 |
| mRNA Refseq | NM_014297 |
| Protein Refseq | NP_055112 |
| MIM | 608451 |
| Uniprot ID | O95571 |
| Chromosome Location | 19q13.32 |
| Function | hydrolase activity; metal ion binding; |
| ◆ Recombinant Proteins | ||
| ETHE1-3522H | Recombinant Human ETHE1 Protein, GST-tagged | +Inquiry |
| ETHE1-28332TH | Recombinant Human ETHE1, His-tagged | +Inquiry |
| ETHE1-331H | Recombinant Human ETHE1, His tagged | +Inquiry |
| ETHE1-4740HF | Recombinant Full Length Human ETHE1 Protein, GST-tagged | +Inquiry |
| ETHE1-5342M | Recombinant Mouse ETHE1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ETHE1-6529HCL | Recombinant Human ETHE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETHE1 Products
Required fields are marked with *
My Review for All ETHE1 Products
Required fields are marked with *
