Recombinant Human ETHE1, His-tagged
Cat.No. : | ETHE1-28406TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 23-239 of Human ETHE1 with an N terminal His tag. Observed mwt: 25 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-239 a.a. |
Description : | This gene encodes a sulfur dioxygenase that localizes within the mitochondrial matrix. The enzyme functions in sulfide catabolism. Mutations in this gene result in ethylmalonic encephalopathy. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitously expressed. |
Form : | Lyophilised:Reconstitute with 117 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDA QLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQS VISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSV HEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLT LSCEEFVKIMGNLNLPKPQQIDF |
Sequence Similarities : | Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family. |
Gene Name | ETHE1 ethylmalonic encephalopathy 1 [ Homo sapiens ] |
Official Symbol | ETHE1 |
Synonyms | ETHE1; ethylmalonic encephalopathy 1; protein ETHE1, mitochondrial; HSCO; YF13H12; |
Gene ID | 23474 |
mRNA Refseq | NM_014297 |
Protein Refseq | NP_055112 |
MIM | 608451 |
Uniprot ID | O95571 |
Chromosome Location | 19q13.32 |
Function | hydrolase activity; metal ion binding; |
◆ Recombinant Proteins | ||
ETHE1-28406TH | Recombinant Human ETHE1, His-tagged | +Inquiry |
ETHE1-4740HF | Recombinant Full Length Human ETHE1 Protein, GST-tagged | +Inquiry |
ETHE1-3522H | Recombinant Human ETHE1 Protein, GST-tagged | +Inquiry |
ETHE1-28332TH | Recombinant Human ETHE1, His-tagged | +Inquiry |
ETHE1-331H | Recombinant Human ETHE1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETHE1-6529HCL | Recombinant Human ETHE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETHE1 Products
Required fields are marked with *
My Review for All ETHE1 Products
Required fields are marked with *
0
Inquiry Basket