Recombinant Human ETNK1 Protein, GST-tagged
Cat.No. : | ETNK1-3524H |
Product Overview : | Human ETNK1 full-length ORF ( AAH06111, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.22 kDa |
AA Sequence : | MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ETNK1 ethanolamine kinase 1 [ Homo sapiens ] |
Official Symbol | ETNK1 |
Synonyms | ETNK1; ethanolamine kinase 1; EKI; EKI1; putative protein product of Nbla10396; EKI 1; Nbla10396; |
Gene ID | 55500 |
mRNA Refseq | NM_001039481 |
Protein Refseq | NP_001034570 |
MIM | 609858 |
UniProt ID | Q9HBU6 |
◆ Recombinant Proteins | ||
Etnk1-2880M | Recombinant Mouse Etnk1 Protein, Myc/DDK-tagged | +Inquiry |
ETNK1-3524H | Recombinant Human ETNK1 Protein, GST-tagged | +Inquiry |
ETNK1-2906H | Recombinant Human ETNK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ETNK1-4741HF | Recombinant Full Length Human ETNK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETNK1-6528HCL | Recombinant Human ETNK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETNK1 Products
Required fields are marked with *
My Review for All ETNK1 Products
Required fields are marked with *
0
Inquiry Basket