Recombinant Human ETNK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ETNK1-2906H
Product Overview : ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Molecular Mass : 27.8 kDa
AA Sequence : MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ETNK1 ethanolamine kinase 1 [ Homo sapiens (human) ]
Official Symbol ETNK1
Synonyms ETNK1; ethanolamine kinase 1; EKI; EKI1; putative protein product of Nbla10396; EKI 1; Nbla10396;
Gene ID 55500
mRNA Refseq NM_001039481
Protein Refseq NP_001034570
MIM 609858
UniProt ID Q9HBU6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETNK1 Products

Required fields are marked with *

My Review for All ETNK1 Products

Required fields are marked with *

0
cart-icon