Recombinant Human ETNK1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ETNK1-2906H |
Product Overview : | ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Mass : | 27.8 kDa |
AA Sequence : | MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ETNK1 ethanolamine kinase 1 [ Homo sapiens (human) ] |
Official Symbol | ETNK1 |
Synonyms | ETNK1; ethanolamine kinase 1; EKI; EKI1; putative protein product of Nbla10396; EKI 1; Nbla10396; |
Gene ID | 55500 |
mRNA Refseq | NM_001039481 |
Protein Refseq | NP_001034570 |
MIM | 609858 |
UniProt ID | Q9HBU6 |
◆ Recombinant Proteins | ||
ETNK1-2906H | Recombinant Human ETNK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Etnk1-2880M | Recombinant Mouse Etnk1 Protein, Myc/DDK-tagged | +Inquiry |
ETNK1-4741HF | Recombinant Full Length Human ETNK1 Protein, GST-tagged | +Inquiry |
ETNK1-3524H | Recombinant Human ETNK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETNK1-6528HCL | Recombinant Human ETNK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETNK1 Products
Required fields are marked with *
My Review for All ETNK1 Products
Required fields are marked with *
0
Inquiry Basket