Recombinant Human EVI2A Protein, GST-tagged
Cat.No. : | EVI2A-3545H |
Product Overview : | Human EVI2A full-length ORF ( AAH35572, 25 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EVI2A (Ecotropic Viral Integration Site 2A) is a Protein Coding gene. GO annotations related to this gene include transmembrane signaling receptor activity. An important paralog of this gene is ENSG00000265118. |
Molecular Mass : | 49.06 kDa |
AA Sequence : | SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EVI2A ecotropic viral integration site 2A [ Homo sapiens ] |
Official Symbol | EVI2A |
Synonyms | EVI2A; ecotropic viral integration site 2A; EVI2; protein EVI2A; EVDA; ecotropic viral integration site 2A protein homolog; EVI-2A; |
Gene ID | 2123 |
mRNA Refseq | NM_001003927 |
Protein Refseq | NP_001003927 |
MIM | 158380 |
UniProt ID | P22794 |
◆ Recombinant Proteins | ||
Evi2a-12578M | Recombinant Mouse Evi2a, GST-tagged | +Inquiry |
EVI2A-276H | Recombinant Human EVI2A, Fc-tagged | +Inquiry |
EVI2A-2886M | Recombinant Mouse EVI2A Protein, His (Fc)-Avi-tagged | +Inquiry |
EVI2A-3545H | Recombinant Human EVI2A Protein, GST-tagged | +Inquiry |
RFL29367HF | Recombinant Full Length Human Protein Evi2A(Evi2A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EVI2A-001HCL | Recombinant Human EVI2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EVI2A Products
Required fields are marked with *
My Review for All EVI2A Products
Required fields are marked with *
0
Inquiry Basket