Recombinant Human EVI2A Protein, GST-tagged
| Cat.No. : | EVI2A-3545H |
| Product Overview : | Human EVI2A full-length ORF ( AAH35572, 25 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | EVI2A (Ecotropic Viral Integration Site 2A) is a Protein Coding gene. GO annotations related to this gene include transmembrane signaling receptor activity. An important paralog of this gene is ENSG00000265118. |
| Molecular Mass : | 49.06 kDa |
| AA Sequence : | SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EVI2A ecotropic viral integration site 2A [ Homo sapiens ] |
| Official Symbol | EVI2A |
| Synonyms | EVI2A; ecotropic viral integration site 2A; EVI2; protein EVI2A; EVDA; ecotropic viral integration site 2A protein homolog; EVI-2A; |
| Gene ID | 2123 |
| mRNA Refseq | NM_001003927 |
| Protein Refseq | NP_001003927 |
| MIM | 158380 |
| UniProt ID | P22794 |
| ◆ Recombinant Proteins | ||
| EVI2A-3545H | Recombinant Human EVI2A Protein, GST-tagged | +Inquiry |
| EVI2A-276H | Recombinant Human EVI2A, Fc-tagged | +Inquiry |
| RFL29367HF | Recombinant Full Length Human Protein Evi2A(Evi2A) Protein, His-Tagged | +Inquiry |
| EVI2A-4375HF | Recombinant Full Length Human EVI2A Protein, GST-tagged | +Inquiry |
| Evi2a-12578M | Recombinant Mouse Evi2a, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EVI2A-001HCL | Recombinant Human EVI2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EVI2A Products
Required fields are marked with *
My Review for All EVI2A Products
Required fields are marked with *
