Recombinant Human EWSR1 protein, His-tagged
| Cat.No. : | EWSR1-19H |
| Product Overview : | Recombinant Human ATG13 protein(O75143)(Tyr231-Asp430), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Tyr231-Asp430 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 24 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | YRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSD |
| Gene Name | ATG13 ATG13 autophagy related 13 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ATG13 |
| Synonyms | ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); KIAA0652; autophagy-related protein 13; FLJ20698; |
| Gene ID | 9776 |
| mRNA Refseq | NM_001142673 |
| Protein Refseq | NP_001136145 |
| UniProt ID | O75143 |
| ◆ Recombinant Proteins | ||
| EWSR1-500C | Recombinant Cynomolgus EWSR1 Protein, His-tagged | +Inquiry |
| Ewsr1-985M | Recombinant Mouse Ewsr1 Protein, MYC/DDK-tagged | +Inquiry |
| EWSR1-67HFL | Active Recombinant Full Length Human EWSR1 Protein, C-Flag-tagged | +Inquiry |
| EWSR1-19H | Recombinant Human EWSR1 protein, His-tagged | +Inquiry |
| EWSR1-3553H | Recombinant Human EWSR1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EWSR1-6514HCL | Recombinant Human EWSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EWSR1 Products
Required fields are marked with *
My Review for All EWSR1 Products
Required fields are marked with *



