Recombinant Human EWSR1 protein, His-tagged

• Cat.No.: EWSR1-19H
• Product Overview: Recombinant Human ATG13 protein(O75143)(Tyr231-Asp430), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Tyr231-Asp430
• Tag: C-His
• Form: Phosphate buffered saline
• Molecular Mass: 24 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: YRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSD

Gene Information

• Gene Name: ATG13 ATG13 autophagy related 13 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG13
• Synonyms: ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); KIAA0652; autophagy-related protein 13; FLJ20698
• Gene ID: 9776
• mRNA Refseq: NM_001142673
• Protein Refseq: NP_001136145
• UniProt ID: O75143