Recombinant Human EWSR1 protein, His-tagged

Cat.No. : EWSR1-19H
Product Overview : Recombinant Human ATG13 protein(O75143)(Tyr231-Asp430), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Tyr231-Asp430
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 24 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : YRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSD
Gene Name ATG13 ATG13 autophagy related 13 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG13
Synonyms ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); KIAA0652; autophagy-related protein 13; FLJ20698;
Gene ID 9776
mRNA Refseq NM_001142673
Protein Refseq NP_001136145
UniProt ID O75143

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EWSR1 Products

Required fields are marked with *

My Review for All EWSR1 Products

Required fields are marked with *

0
cart-icon