Recombinant Human EXT1 protein, His-tagged

Cat.No. : EXT1-2682H
Product Overview : Recombinant Human EXT1 protein(435-573 aa), fused to His tag, was expressed in E. coli.
Availability November 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 435-573 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : FKHISRNSLIWNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIEGESKVMSSRFLPYDNIITDAVLSLDEDTVLSTT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EXT1 exostosin 1 [ Homo sapiens ]
Official Symbol EXT1
Synonyms EXT1; exostosin 1; exostoses (multiple) 1 , Langer Giedion syndrome chromosome region , LGCR, LGS; exostosin-1; Glucuronosyl N acetylglucosaminyl proteoglycan 4 alpha N acetylglucosaminyltransferase; N acetylglucosaminyl proteoglycan 4 beta glucuronosyltransferase; ttv; exostoses (multiple) 1; multiple exostoses protein 1; putative tumor suppressor protein EXT1; Langer-Giedion syndrome chromosome region; N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase; Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferase; glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; EXT; LGS; TTV; LGCR; TRPS2;
Gene ID 2131
mRNA Refseq NM_000127
Protein Refseq NP_000118
MIM 608177
UniProt ID Q16394

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXT1 Products

Required fields are marked with *

My Review for All EXT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon