Recombinant Human EXT1 protein, His-tagged
| Cat.No. : | EXT1-2682H |
| Product Overview : | Recombinant Human EXT1 protein(435-573 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 435-573 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | FKHISRNSLIWNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIEGESKVMSSRFLPYDNIITDAVLSLDEDTVLSTT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EXT1 exostosin 1 [ Homo sapiens ] |
| Official Symbol | EXT1 |
| Synonyms | EXT1; exostosin 1; exostoses (multiple) 1 , Langer Giedion syndrome chromosome region , LGCR, LGS; exostosin-1; Glucuronosyl N acetylglucosaminyl proteoglycan 4 alpha N acetylglucosaminyltransferase; N acetylglucosaminyl proteoglycan 4 beta glucuronosyltransferase; ttv; exostoses (multiple) 1; multiple exostoses protein 1; putative tumor suppressor protein EXT1; Langer-Giedion syndrome chromosome region; N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase; Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferase; glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; EXT; LGS; TTV; LGCR; TRPS2; |
| Gene ID | 2131 |
| mRNA Refseq | NM_000127 |
| Protein Refseq | NP_000118 |
| MIM | 608177 |
| UniProt ID | Q16394 |
| ◆ Recombinant Proteins | ||
| RFL18736MF | Recombinant Full Length Mouse Exostosin-1(Ext1) Protein, His-Tagged | +Inquiry |
| EXT1-2682H | Recombinant Human EXT1 protein, His-tagged | +Inquiry |
| EXT1-3583H | Recombinant Human EXT1 Protein, GST-tagged | +Inquiry |
| EXT1-3274H | Recombinant Human EXT1 protein, His-tagged | +Inquiry |
| EXT1-2908M | Recombinant Mouse EXT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EXT1-6497HCL | Recombinant Human EXT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXT1 Products
Required fields are marked with *
My Review for All EXT1 Products
Required fields are marked with *
