Recombinant Human EZH2, His-tagged

Cat.No. : EZH2-29233TH
Product Overview : Recombinant fragment, corresponding to amino acids 558-707 of Human KMT6/EZH2 isoform 3 with an N-terminal His Tag, 150 amino aicds, approximately 24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 558-707 a.a.
Description : This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation : HIS
Tissue specificity : Expressed in many tissues. Overexpressed in numerous tumor types including carcinomas of the breast, colon, larynx, lymphoma and testis.
Form : Lyophilised:reconstitution with 60 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNE FISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFV VDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFA KRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
Sequence Similarities : Belongs to the histone-lysine methyltransferase family. EZ subfamily.Contains 1 SET domain.
Gene Name EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol EZH2
Synonyms EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A;
Gene ID 2146
mRNA Refseq NM_001203247
Protein Refseq NP_001190176
MIM 601573
Uniprot ID Q15910
Chromosome Location 7q35-q36
Function DNA binding; histone methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EZH2 Products

Required fields are marked with *

My Review for All EZH2 Products

Required fields are marked with *

0
cart-icon