Recombinant Human EZH2 protein, GST-tagged
| Cat.No. : | EZH2-1826H |
| Product Overview : | Recombinant Human EZH2 protein(158-261 aa), fused to GST tag, was expressed in E. coli. |
| Availability | June 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 158-261 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ] |
| Official Symbol | EZH2 |
| Synonyms | EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; lysine N-methyltransferase 6; ENX1; WVS2; ENX-1; MGC9169; |
| Gene ID | 2146 |
| mRNA Refseq | NM_001203247 |
| Protein Refseq | NP_001190176 |
| MIM | 601573 |
| UniProt ID | Q15910 |
| ◆ Recombinant Proteins | ||
| EZH2-173H | Active Recombinant Human EZH2 Complex protein, His/Flag-tagged | +Inquiry |
| EZH2-29233TH | Recombinant Human EZH2, His-tagged | +Inquiry |
| EZH2-4654Z | Recombinant Zebrafish EZH2 | +Inquiry |
| EZH2-169H | Recombinant Human EZH2 Complex protein, His-tagged | +Inquiry |
| EZH2-542H | Recombinant Human EZH2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EZH2-6487HCL | Recombinant Human EZH2 293 Cell Lysate | +Inquiry |
| EZH2-162HKCL | Human EZH2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EZH2 Products
Required fields are marked with *
My Review for All EZH2 Products
Required fields are marked with *
