Recombinant Human EZH2 protein, GST-tagged

• Cat.No.: EZH2-1826H
• Product Overview: Recombinant Human EZH2 protein(158-261 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 158-261 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ]
• Official Symbol: EZH2
• Synonyms: EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; lysine N-methyltransferase 6; ENX1; WVS2; ENX-1; MGC9169
• Gene ID: 2146
• mRNA Refseq: NM_001203247
• Protein Refseq: NP_001190176
• MIM: 601573
• UniProt ID: Q15910