Recombinant Human F13A1 Protein, His-tagged
Cat.No. : | F13A1-1330H |
Product Overview : | Recombinant Human F13A1(Gly39-Met732) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Gly39-Met732 |
Description : | Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as plasma carrier molecules. Platelet factor XIII is composed of just 2 A subunits, which are identical to those of plasma origin. Upon cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. |
Form : | Supplied as a 0.2 μm filtered solution of 50 mM NaCl,5% Sucrose, 1% Tween 20 (v/v),0.3% Histidine (w/v),pH8.0. |
AA Sequence : | GVNLQEFLNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVE YVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPY GVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFED GILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVD ILLEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGNVNS KLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKHGHVCFQFD APFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERL ALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITFRNNSHNRYTITAYLSANI TFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQ KSTVLTIPEIIIKVRGTQVVGSDMTVTVQFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNS TVQWEEVCRPWVSGHRKLIASMSSDSLRHVYGELDVQIQRRPSMVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | F13A1 coagulation factor XIII, A1 polypeptide [ Homo sapiens ] |
Official Symbol | F13A1 |
Synonyms | F13A1; coagulation factor XIII, A1 polypeptide; F13A; coagulation factor XIII A chain; TGase; factor XIIIa; fibrinoligase; FSF, A subunit; coagulation factor XIIIa; transglutaminase A chain; transglutaminase. plasma; fibrin stabilizing factor, A subunit; coagulation factor XIII, A polypeptide; protein-glutamine gamma-glutamyltransferase A chain; bA525O21.1 (coagulation factor XIII, A1 polypeptide); |
Gene ID | 2162 |
mRNA Refseq | NM_000129 |
Protein Refseq | NP_000120 |
MIM | 134570 |
UniProt ID | P00488 |
◆ Recombinant Proteins | ||
F13A1-12618H | Recombinant Human F13A1, His-tagged | +Inquiry |
F13a1-2900M | Recombinant Mouse F13a1 Protein, Myc/DDK-tagged | +Inquiry |
F13A1-4494HF | Recombinant Full Length Human F13A1 Protein, GST-tagged | +Inquiry |
F13A1-125H | Recombinant Human F13A1 Protein, MYC/DDK-tagged | +Inquiry |
F13A1-5398H | Recombinant Human F13A1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
F13A1-6485HCL | Recombinant Human F13A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F13A1 Products
Required fields are marked with *
My Review for All F13A1 Products
Required fields are marked with *
0
Inquiry Basket