Recombinant Human F8 protein, His-GST-tagged
| Cat.No. : | F8-3215H |
| Product Overview : | Recombinant Human F8 protein(P00451)(1-216aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 1-216aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 56.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY |
| Gene Name | F8 coagulation factor VIII, procoagulant component [ Homo sapiens ] |
| Official Symbol | F8 |
| Synonyms | F8; coagulation factor VIII, procoagulant component; F8C; coagulation factor VIII; DXS1253E; Factor VIIIF8B; FVIII; HEMA; hemophilia A; factor VIII F8B; antihemophilic factor; coagulation factor VIIIc; AHF; F8B; |
| Gene ID | 2157 |
| mRNA Refseq | NM_000132 |
| Protein Refseq | NP_000123 |
| MIM | 300841 |
| UniProt ID | P00451 |
| ◆ Recombinant Proteins | ||
| F8-126H | Recombinant Human F8, GST-tagged | +Inquiry |
| F8-13HFL | Recombinant Full Length Human F8 Protein | +Inquiry |
| F8-2397H | Recombinant Human Coagulation Factor VIII, Procoagulant Component | +Inquiry |
| F8-125H | Recombinant Human Coagulation Factor VIII, Procoagulant Component | +Inquiry |
| F8-3065H | Human Factor-VIII | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F8-6482HCL | Recombinant Human F8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F8 Products
Required fields are marked with *
My Review for All F8 Products
Required fields are marked with *
