Recombinant Human FABP5 protein, GST-tagged
Cat.No. : | FABP5-4244H |
Product Overview : | Recombinant Human FABP5 protein(Q01469)(1-135aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-135aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | FABP5 fatty acid binding protein 5 (psoriasis-associated) [ Homo sapiens ] |
Official Symbol | FABP5 |
Synonyms | FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP; |
Gene ID | 2171 |
mRNA Refseq | NM_001444 |
Protein Refseq | NP_001435 |
MIM | 605168 |
UniProt ID | Q01469 |
◆ Recombinant Proteins | ||
FABP5-3366H | Recombinant Human FABP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FABP5-4244H | Recombinant Human FABP5 protein, GST-tagged | +Inquiry |
Fabp5-1273M | Recombinant Mouse Fabp5 Protein, MYC/DDK-tagged | +Inquiry |
Fabp5-255M | Recombinant Mouse Fabp5, His-tagged | +Inquiry |
FABP5-3636H | Recombinant Human FABP5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP5-6476HCL | Recombinant Human FABP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP5 Products
Required fields are marked with *
My Review for All FABP5 Products
Required fields are marked with *