Recombinant Human FADS1
Cat.No. : | FADS1-28816TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-99 of Human FADS1, with a N terminal proprietary tag; predicted MW: 36.52 inclusive of tag. O60427, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Expressed in many tissues, it is most abundant in the liver, brain, adrenal gland and heart. Found as well in skeletal muscle, lung, placenta, kidney, pancreas and retina. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS |
Sequence Similarities : | Belongs to the fatty acid desaturase family.Contains 1 cytochrome b5 heme-binding domain. |
Gene Name | FADS1 fatty acid desaturase 1 [ Homo sapiens ] |
Official Symbol | FADS1 |
Synonyms | FADS1; fatty acid desaturase 1; LLCDL1; D5D; delta 5 desaturase; FADS6; FADSD5; TU12; |
Gene ID | 3992 |
mRNA Refseq | NM_013402 |
Protein Refseq | NP_037534 |
MIM | 606148 |
Uniprot ID | O60427 |
Chromosome Location | 11q12-q13.1 |
Pathway | Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
Function | C-5 sterol desaturase activity; heme binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
FADS1-12639H | Recombinant Human FADS1, GST-tagged | +Inquiry |
FADS1-622HF | Recombinant Full Length Human FADS1 Protein, GST-tagged | +Inquiry |
FADS1-5431M | Recombinant Mouse FADS1 Protein | +Inquiry |
RFL13823RF | Recombinant Full Length Rat Fatty Acid Desaturase 1(Fads1) Protein, His-Tagged | +Inquiry |
FADS1-28816TH | Recombinant Human FADS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FADS1-6472HCL | Recombinant Human FADS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADS1 Products
Required fields are marked with *
My Review for All FADS1 Products
Required fields are marked with *