Recombinant Human FADS1 protein, GST-tagged
| Cat.No. : | FADS1-28817H |
| Product Overview : | Recombinant Human FADS1(1 a.a. - 444 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 444 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 74.47 kDa |
| AA Sequence : | MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFH INKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHILLLDGAAWLTL WVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNC FRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPSALLPLYFQWYIFYFVIQRKKWVDLAWMI TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQLQATCNVHKSAFNDWF SGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDAYLHQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | FADS1 fatty acid desaturase 1 [ Homo sapiens ] |
| Official Symbol | FADS1 |
| Synonyms | FADS1; fatty acid desaturase 1; LLCDL1; D5D; delta 5 desaturase; FADS6; FADSD5; TU12; delta-5 desaturase; delta(5) desaturase; delta-5 fatty acid desaturase; delta(5) fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 1; FLJ38956; FLJ90273; |
| Gene ID | 3992 |
| mRNA Refseq | NM_013402 |
| Protein Refseq | NP_037534 |
| MIM | 606148 |
| UniProt ID | O60427 |
| Chromosome Location | 11q12-q13.1 |
| Pathway | Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
| Function | C-5 sterol desaturase activity; heme binding; oxidoreductase activity; |
| ◆ Recombinant Proteins | ||
| RFL13823RF | Recombinant Full Length Rat Fatty Acid Desaturase 1(Fads1) Protein, His-Tagged | +Inquiry |
| RFL8336HF | Recombinant Full Length Human Fatty Acid Desaturase 1(Fads1) Protein, His-Tagged | +Inquiry |
| FADS1-17H | Recombinant Human FADS1 Protein, His-tagged | +Inquiry |
| FADS1-1849R | Recombinant Rat FADS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FADS1-28816TH | Recombinant Human FADS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FADS1-6472HCL | Recombinant Human FADS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADS1 Products
Required fields are marked with *
My Review for All FADS1 Products
Required fields are marked with *
