Recombinant Human FADS1 protein, GST-tagged
Cat.No. : | FADS1-28817H |
Product Overview : | Recombinant Human FADS1(1 a.a. - 444 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | September 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 444 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 74.47 kDa |
AA Sequence : | MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFH INKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHILLLDGAAWLTL WVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNC FRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPSALLPLYFQWYIFYFVIQRKKWVDLAWMI TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQLQATCNVHKSAFNDWF SGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDAYLHQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | FADS1 fatty acid desaturase 1 [ Homo sapiens ] |
Official Symbol | FADS1 |
Synonyms | FADS1; fatty acid desaturase 1; LLCDL1; D5D; delta 5 desaturase; FADS6; FADSD5; TU12; delta-5 desaturase; delta(5) desaturase; delta-5 fatty acid desaturase; delta(5) fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 1; FLJ38956; FLJ90273; |
Gene ID | 3992 |
mRNA Refseq | NM_013402 |
Protein Refseq | NP_037534 |
MIM | 606148 |
UniProt ID | O60427 |
Chromosome Location | 11q12-q13.1 |
Pathway | Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
Function | C-5 sterol desaturase activity; heme binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
FADS1-28817H | Recombinant Human FADS1 protein, GST-tagged | +Inquiry |
FADS1-1849R | Recombinant Rat FADS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8336HF | Recombinant Full Length Human Fatty Acid Desaturase 1(Fads1) Protein, His-Tagged | +Inquiry |
FADS1-2192R | Recombinant Rat FADS1 Protein | +Inquiry |
FADS1-5431M | Recombinant Mouse FADS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FADS1-6472HCL | Recombinant Human FADS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADS1 Products
Required fields are marked with *
My Review for All FADS1 Products
Required fields are marked with *