Recombinant Human FADS2 protein, His-SUMO-tagged
| Cat.No. : | FADS2-2882H |
| Product Overview : | Recombinant Human FADS2 protein(O95864)(1-131aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-131aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.9 kDa |
| AA Sequence : | MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FADS2 fatty acid desaturase 2 [ Homo sapiens ] |
| Official Symbol | FADS2 |
| Synonyms | FADS2; fatty acid desaturase 2; LLCDL2; D6D; delta 6 desaturase; DES6; FADSD6; SLL0262; TU13; delta-6 desaturase; delta-6-desaturase; delta(6) desaturase; delta-6 fatty acid desaturase; delta(6) fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 2; |
| Gene ID | 9415 |
| mRNA Refseq | NM_004265 |
| Protein Refseq | NP_004256 |
| MIM | 606149 |
| UniProt ID | O95864 |
| ◆ Recombinant Proteins | ||
| FADS2-2934M | Recombinant Mouse FADS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FADS2-5432M | Recombinant Mouse FADS2 Protein | +Inquiry |
| FADS2-16H | Recombinant Human FADS2 Protein, His-tagged | +Inquiry |
| FADS2-3643H | Recombinant Human FADS2 Protein, GST-tagged | +Inquiry |
| RFL8080RF | Recombinant Full Length Rat Fatty Acid Desaturase 2(Fads2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADS2 Products
Required fields are marked with *
My Review for All FADS2 Products
Required fields are marked with *
