Recombinant Human FAM136A Protein, GST-tagged

Cat.No. : FAM136A-3708H
Product Overview : Human FAM136A full-length ORF (BAB55208.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a mitochondrially localized protein that is highly conserved across species. The gene is expressed in a variety of tissues including human lymphoblast cells and rat neurosensorial epithelium of the cristaampullaris. A mutation in this gene has been associated with familial Meniere's disease, a chronic disorder of the inner ear. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]
Molecular Mass : 42.1 kDa
AA Sequence : MAELQQLRVQEAMESMVKSLERENIRKMQGLMFRCSASCCEDSQAFMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM136A family with sequence similarity 136, member A [ Homo sapiens ]
Official Symbol FAM136A
Synonyms FAM136A; family with sequence similarity 136, member A; protein FAM136A; FLJ14668; hypothetical protein FLJ14668;
Gene ID 84908
mRNA Refseq NM_032822
Protein Refseq NP_116211
MIM 616275
UniProt ID Q96C01

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM136A Products

Required fields are marked with *

My Review for All FAM136A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon