Recombinant Human FAM19A5 Protein, GST-tagged
Cat.No. : | FAM19A5-3733H |
Product Overview : | Human FAM19A5 full-length ORF (BAG53905.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines that act as regulators of immune and nervous cells. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 40 kDa |
AA Sequence : | MQLLKALWALAGAALCCFLVLVIHAQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM19A5 family with sequence similarity 19 member A5, C-C motif chemokine like [ Homo sapiens (human) ] |
Official Symbol | FAM19A5 |
Synonyms | FAM19A5; family with sequence similarity 19 member A5, C-C motif chemokine like; Family With Sequence Similarity 19 Member A5, C-C Motif Chemokine Like; Family With Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A5; Chemokine-Like Protein TAFA-5; TAFA5; Protein FAM19A5; TAFA Protein 5; QLLK5208; UNQ5208; TAFA-5; protein FAM19A5; TAFA protein 5; chemokine-like protein TAFA-5; family with sequence similarity 19 (chemokine (C-C motif)-like), member A5 |
Gene ID | 25817 |
mRNA Refseq | NM_001082967 |
Protein Refseq | NP_001076436 |
MIM | 617499 |
UniProt ID | Q7Z5A7 |
◆ Recombinant Proteins | ||
FAM19A5-1602H | Recombinant Human FAM19A5 protein, His-tagged | +Inquiry |
FAM19A5-4547HF | Recombinant Full Length Human FAM19A5 Protein, GST-tagged | +Inquiry |
RFL18051MF | Recombinant Full Length Mouse Protein Fam19A5(Fam19A5) Protein, His-Tagged | +Inquiry |
FAM19A5-3733H | Recombinant Human FAM19A5 Protein, GST-tagged | +Inquiry |
FAM19A5-3045M | Recombinant Mouse FAM19A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FAM19A5-001H | Recombinant Human FAM19A5 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM19A5-6386HCL | Recombinant Human FAM19A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM19A5 Products
Required fields are marked with *
My Review for All FAM19A5 Products
Required fields are marked with *
0
Inquiry Basket