Recombinant Full Length Human Protein Fam19A5(Fam19A5) Protein, His-Tagged
Cat.No. : | RFL22772HF |
Product Overview : | Recombinant Full Length Human Protein FAM19A5(FAM19A5) Protein (Q7Z5A7) (1-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-132) |
Form : | Lyophilized powder |
AA Sequence : | MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT IARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCT QPGGRIKTTTVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAM19A5 |
Synonyms | TAFA5; FAM19A5; UNQ5208/PRO34524; Chemokine-like protein TAFA-5 |
UniProt ID | Q7Z5A7 |
◆ Recombinant Proteins | ||
FAM19A5-5575M | Recombinant Mouse FAM19A5 Protein | +Inquiry |
RFL18051MF | Recombinant Full Length Mouse Protein Fam19A5(Fam19A5) Protein, His-Tagged | +Inquiry |
FAM19A5-1603M | Recombinant Mouse FAM19A5 protein, His-tagged | +Inquiry |
FAM19A5-4547HF | Recombinant Full Length Human FAM19A5 Protein, GST-tagged | +Inquiry |
RFL22772HF | Recombinant Full Length Human Protein Fam19A5(Fam19A5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FAM19A5-001H | Recombinant Human FAM19A5 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM19A5-6386HCL | Recombinant Human FAM19A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM19A5 Products
Required fields are marked with *
My Review for All FAM19A5 Products
Required fields are marked with *
0
Inquiry Basket