Recombinant Human FAM19A5 Protein, His tagged

Cat.No. : FAM19A5-001H
Product Overview : Recombinant Human FAM19A5 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 26-125 aa
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
AA Sequence : MQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVSHHHHHHHH
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Concentration : 1 mg/mL by BCA
Official Symbol TAFA5
Synonyms TAFA5; TAFA chemokine like family member 5; TAFA-5; FAM19A5; UNQ5208; QLLK5208; chemokine-like protein TAFA-5; TAFA protein 5; family with sequence similarity 19 (chemokine (C-C motif)-like), member A5; family with sequence similarity 19 member A5, C-C motif chemokine like; protein FAM19A5
Gene ID 25817
mRNA Refseq NM_015381
Protein Refseq NP_056196
MIM 617499
UniProt ID Q7Z5A7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM19A5 Products

Required fields are marked with *

My Review for All FAM19A5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon