Recombinant Human FAM19A5 Protein, His tagged
Cat.No. : | FAM19A5-001H |
Product Overview : | Recombinant Human FAM19A5 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 26-125 aa |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
AA Sequence : | MQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVSHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Concentration : | 1 mg/mL by BCA |
Official Symbol | TAFA5 |
Synonyms | TAFA5; TAFA chemokine like family member 5; TAFA-5; FAM19A5; UNQ5208; QLLK5208; chemokine-like protein TAFA-5; TAFA protein 5; family with sequence similarity 19 (chemokine (C-C motif)-like), member A5; family with sequence similarity 19 member A5, C-C motif chemokine like; protein FAM19A5 |
Gene ID | 25817 |
mRNA Refseq | NM_015381 |
Protein Refseq | NP_056196 |
MIM | 617499 |
UniProt ID | Q7Z5A7 |
◆ Recombinant Proteins | ||
FAM19A5-1602H | Recombinant Human FAM19A5 protein, His-tagged | +Inquiry |
FAM19A5-1603M | Recombinant Mouse FAM19A5 protein, His-tagged | +Inquiry |
FAM19A5-3733H | Recombinant Human FAM19A5 Protein, GST-tagged | +Inquiry |
FAM19A5-690H | Active Recombinant Human FAM19A5 | +Inquiry |
RFL18051MF | Recombinant Full Length Mouse Protein Fam19A5(Fam19A5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FAM19A5-001H | Recombinant Human FAM19A5 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM19A5-6386HCL | Recombinant Human FAM19A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM19A5 Products
Required fields are marked with *
My Review for All FAM19A5 Products
Required fields are marked with *
0
Inquiry Basket