Recombinant Human FAM3C Protein, GST-tagged
| Cat.No. : | FAM3C-3754H |
| Product Overview : | Human FAM3C full-length ORF (AAH46932, 25 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010] |
| Molecular Mass : | 48.07 kDa |
| AA Sequence : | QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM3C family with sequence similarity 3, member C [ Homo sapiens ] |
| Official Symbol | FAM3C |
| Synonyms | FAM3C; family with sequence similarity 3, member C; protein FAM3C; GS3876; ILEI; interleukin like EMT inducer; predicted osteoblast protein; interleukin-like EMT inducer; GS3786; |
| Gene ID | 10447 |
| mRNA Refseq | NM_001040020 |
| Protein Refseq | NP_001035109 |
| MIM | 608618 |
| UniProt ID | Q92520 |
| ◆ Recombinant Proteins | ||
| FAM3C-3754H | Recombinant Human FAM3C Protein, GST-tagged | +Inquiry |
| FAM3C-4586HF | Recombinant Full Length Human FAM3C Protein, GST-tagged | +Inquiry |
| FAM3C-3705C | Recombinant Chicken FAM3C | +Inquiry |
| FAM3C-2664H | Recombinant Human FAM3C Protein (Gln25-Asp227), C-His tagged | +Inquiry |
| FAM3C-1609R | Recombinant Rhesus monkey FAM3C Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM3C-942HCL | Recombinant Human FAM3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3C Products
Required fields are marked with *
My Review for All FAM3C Products
Required fields are marked with *
