Recombinant Human FAM50A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM50A-485H |
Product Overview : | FAM50A MS Standard C13 and N15-labeled recombinant protein (NP_004690) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM50A family with sequence similarity 50 member A [ Homo sapiens (human) ] |
Official Symbol | FAM50A |
Synonyms | FAM50A; family with sequence similarity 50, member A; protein FAM50A; 9F; DNA segment on chromosome X (unique) 9928 expressed sequence; DXS9928E; HXC 26; XAP5; protein XAP-5; HXC26; HXC-26; |
Gene ID | 9130 |
mRNA Refseq | NM_004699 |
Protein Refseq | NP_004690 |
MIM | 300453 |
UniProt ID | Q14320 |
◆ Recombinant Proteins | ||
FAM50A-28823TH | Recombinant Human FAM50A, His-tagged | +Inquiry |
FAM50A-12708H | Recombinant Human FAM50A, His-tagged | +Inquiry |
FAM50A-3774H | Recombinant Human FAM50A Protein, GST-tagged | +Inquiry |
Fam50a-371M | Recombinant Mouse Fam50a Protein, MYC/DDK-tagged | +Inquiry |
FAM50A-348H | Recombinant Human FAM50A Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM50A Products
Required fields are marked with *
My Review for All FAM50A Products
Required fields are marked with *