Recombinant Human FAM76A Protein, GST-tagged
| Cat.No. : | FAM76A-3800H |
| Product Overview : | Human FAM76A full-length ORF ( NP_689873.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM76A (Family With Sequence Similarity 76 Member A) is a Protein Coding gene. An important paralog of this gene is FAM76B. |
| Molecular Mass : | 61.4 kDa |
| AA Sequence : | MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM76A family with sequence similarity 76, member A [ Homo sapiens ] |
| Official Symbol | FAM76A |
| Synonyms | FAM76A; family with sequence similarity 76, member A; protein FAM76A; MGC34648; RP3-426I6.1; FLJ41946; |
| Gene ID | 199870 |
| mRNA Refseq | NM_001143912 |
| Protein Refseq | NP_001137384 |
| UniProt ID | Q8TAV0 |
| ◆ Recombinant Proteins | ||
| FAM76A-2367H | Recombinant Human FAM76A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FAM76A-3800H | Recombinant Human FAM76A Protein, GST-tagged | +Inquiry |
| FAM76A-12725H | Recombinant Human FAM76A, GST-tagged | +Inquiry |
| FAM76A-3028C | Recombinant Chicken FAM76A | +Inquiry |
| Fam76a-2945M | Recombinant Mouse Fam76a Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM76A-6350HCL | Recombinant Human FAM76A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM76A Products
Required fields are marked with *
My Review for All FAM76A Products
Required fields are marked with *




