Recombinant Human FAM81A Protein, GST-tagged

Cat.No. : FAM81A-3802H
Product Overview : Human FAM81A full-length ORF ( NP_689663.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM81A (Family With Sequence Similarity 81 Member A) is a Protein Coding gene. An important paralog of this gene is FAM81B.
Molecular Mass : 68.4 kDa
AA Sequence : MHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVNSLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTLEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEGQISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSIRQVLEAKMKLDRDQLQKQIQLMQKPETPM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM81A family with sequence similarity 81, member A [ Homo sapiens ]
Official Symbol FAM81A
Synonyms FAM81A; family with sequence similarity 81, member A; protein FAM81A; MGC26690;
Gene ID 145773
mRNA Refseq NM_152450
Protein Refseq NP_689663
UniProt ID Q8TBF8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM81A Products

Required fields are marked with *

My Review for All FAM81A Products

Required fields are marked with *

0
cart-icon