Recombinant Human FAM96A Protein, GST-tagged
| Cat.No. : | FAM96A-3815H | 
| Product Overview : | Human FAM96A full-length ORF ( NP_115607.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | FAM96A (Family With Sequence Similarity 96 Member A) is a Protein Coding gene. An important paralog of this gene is FAM96B. | 
| Molecular Mass : | 44.8 kDa | 
| AA Sequence : | MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FAM96A family with sequence similarity 96, member A [ Homo sapiens ] | 
| Official Symbol | FAM96A | 
| Synonyms | FAM96A; family with sequence similarity 96, member A; Family With Sequence Similarity 96 Member A; Family With Sequence Similarity 96, Member A; MIP18 Family Protein FAM96A; CIA2A | 
| Gene ID | 84191 | 
| mRNA Refseq | NM_032231 | 
| Protein Refseq | NP_115607 | 
| UniProt ID | Q9H5X1 | 
| ◆ Recombinant Proteins | ||
| FAM96A-12731H | Recombinant Human FAM96A, GST-tagged | +Inquiry | 
| FAM96A-4654HF | Recombinant Full Length Human FAM96A Protein, GST-tagged | +Inquiry | 
| FAM96A-2269C | Recombinant Chicken FAM96A | +Inquiry | 
| FAM96A-3815H | Recombinant Human FAM96A Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FAM96A-6338HCL | Recombinant Human FAM96A 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM96A Products
Required fields are marked with *
My Review for All FAM96A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            