Recombinant Human FAM96A Protein, GST-tagged

Cat.No. : FAM96A-3815H
Product Overview : Human FAM96A full-length ORF ( NP_115607.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM96A (Family With Sequence Similarity 96 Member A) is a Protein Coding gene. An important paralog of this gene is FAM96B.
Molecular Mass : 44.8 kDa
AA Sequence : MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM96A family with sequence similarity 96, member A [ Homo sapiens ]
Official Symbol FAM96A
Synonyms FAM96A; family with sequence similarity 96, member A; Family With Sequence Similarity 96 Member A; Family With Sequence Similarity 96, Member A; MIP18 Family Protein FAM96A; CIA2A
Gene ID 84191
mRNA Refseq NM_032231
Protein Refseq NP_115607
UniProt ID Q9H5X1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM96A Products

Required fields are marked with *

My Review for All FAM96A Products

Required fields are marked with *

0
cart-icon