Recombinant Human FANCB

Cat.No. : FANCB-27930TH
Product Overview : Recombinant fragment of Human FANCB with a N terminal proprietary tag; Predicted MW 37.65 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 109 amino acids
Description : The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein.
Molecular Weight : 37.620kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNFMQRCE VSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLK VSGALYREITLKVAEVQLKSDFAAQKLSN
Gene Name FANCB Fanconi anemia, complementation group B [ Homo sapiens ]
Official Symbol FANCB
Synonyms FANCB; Fanconi anemia, complementation group B; Fanconi anemia group B protein; FAAP95; FAB; FLJ34064;
Gene ID 2187
mRNA Refseq NM_001018113
Protein Refseq NP_001018123
MIM 300515
Uniprot ID Q8NB91
Chromosome Location Xp22.2
Pathway DNA Repair, organism-specific biosystem; FA core complex, organism-specific biosystem; Fanconi Anemia pathway, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; Fanconi anemia pathway, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FANCB Products

Required fields are marked with *

My Review for All FANCB Products

Required fields are marked with *

0
cart-icon
0
compare icon