Recombinant Human FANCB
| Cat.No. : | FANCB-27930TH |
| Product Overview : | Recombinant fragment of Human FANCB with a N terminal proprietary tag; Predicted MW 37.65 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein. |
| Protein length : | 109 amino acids |
| Molecular Weight : | 37.620kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNFMQRCE VSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLK VSGALYREITLKVAEVQLKSDFAAQKLSN |
| Gene Name : | FANCB Fanconi anemia, complementation group B [ Homo sapiens ] |
| Official Symbol : | FANCB |
| Synonyms : | FANCB; Fanconi anemia, complementation group B; Fanconi anemia group B protein; FAAP95; FAB; FLJ34064; |
| Gene ID : | 2187 |
| mRNA Refseq : | NM_001018113 |
| Protein Refseq : | NP_001018123 |
| MIM : | 300515 |
| Uniprot ID : | Q8NB91 |
| Chromosome Location : | Xp22.2 |
| Pathway : | DNA Repair, organism-specific biosystem; FA core complex, organism-specific biosystem; Fanconi Anemia pathway, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; Fanconi anemia pathway, conserved biosystem; |
Products Types
| ◆ Recombinant Protein | ||
| FANCB-3826H | Recombinant Human FANCB Protein, GST-tagged | +Inquiry |
| FANCB-3812Z | Recombinant Zebrafish FANCB | +Inquiry |
| FANCB-4236C | Recombinant Chicken FANCB | +Inquiry |
| ◆ Lysates | ||
| FANCB-593HCL | Recombinant Human FANCB cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
