Recombinant Human FANCF Protein, GST-tagged
| Cat.No. : | FANCF-3831H |
| Product Overview : | Human FANCF full-length ORF ( NP_073562.1, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group F. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 68.7 kDa |
| AA Sequence : | MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FANCF Fanconi anemia, complementation group F [ Homo sapiens ] |
| Official Symbol | FANCF |
| Synonyms | FANCF; Fanconi anemia, complementation group F; Fanconi anemia group F protein; FAF; MGC126856; |
| Gene ID | 2188 |
| mRNA Refseq | NM_022725 |
| Protein Refseq | NP_073562 |
| MIM | 613897 |
| UniProt ID | Q9NPI8 |
| ◆ Recombinant Proteins | ||
| FANCF-4248Z | Recombinant Zebrafish FANCF | +Inquiry |
| FANCF-4666HF | Recombinant Full Length Human FANCF Protein, GST-tagged | +Inquiry |
| FANCF-3831H | Recombinant Human FANCF Protein, GST-tagged | +Inquiry |
| FANCF-28386TH | Recombinant Human FANCF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FANCF-6332HCL | Recombinant Human FANCF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FANCF Products
Required fields are marked with *
My Review for All FANCF Products
Required fields are marked with *




