Recombinant Human FANCI protein, His-tagged
Cat.No. : | FANCI-0404H |
Product Overview : | Recombinant Human FANCI protein(1-252 aa), fused to His tag, was expressed in E. coli. |
Availability | August 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-252 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FANCI Fanconi anemia, complementation group I [ Homo sapiens ] |
Official Symbol | FANCI |
Synonyms | FANCI; Fanconi anemia, complementation group I; KIAA1794; Fanconi anemia group I protein; FLJ10719; |
Gene ID | 55215 |
mRNA Refseq | NM_001113378 |
Protein Refseq | NP_001106849 |
MIM | 611360 |
UniProt ID | Q9NVI1 |
◆ Recombinant Proteins | ||
FANCI-5673M | Recombinant Mouse FANCI Protein | +Inquiry |
FANCI-3824C | Recombinant Chicken FANCI | +Inquiry |
FANCI-4675Z | Recombinant Zebrafish FANCI | +Inquiry |
FANCI-4844HF | Recombinant Full Length Human FANCI Protein, GST-tagged | +Inquiry |
FANCI-12740H | Recombinant Human FANCI, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANCI-627HCL | Recombinant Human FANCI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FANCI Products
Required fields are marked with *
My Review for All FANCI Products
Required fields are marked with *