Recombinant Human FANCI Protein, GST-tagged

Cat.No. : FANCI-4220H
Product Overview : Human FLJ10719 full-length ORF ( AAH04277, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group I. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
Molecular Mass : 33.77 kDa
AA Sequence : MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FANCI Fanconi anemia, complementation group I [ Homo sapiens ]
Official Symbol FANCI
Synonyms FANCI; Fanconi anemia, complementation group I; KIAA1794; Fanconi anemia group I protein; FLJ10719;
Gene ID 55215
mRNA Refseq NM_001113378
Protein Refseq NP_001106849
MIM 611360
UniProt ID Q9NVI1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FANCI Products

Required fields are marked with *

My Review for All FANCI Products

Required fields are marked with *

0
cart-icon
0
compare icon