Recombinant Human FANCI Protein, GST-tagged
| Cat.No. : | FANCI-4220H |
| Product Overview : | Human FLJ10719 full-length ORF ( AAH04277, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group I. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq |
| Molecular Mass : | 33.77 kDa |
| AA Sequence : | MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FANCI Fanconi anemia, complementation group I [ Homo sapiens ] |
| Official Symbol | FANCI |
| Synonyms | FANCI; Fanconi anemia, complementation group I; KIAA1794; Fanconi anemia group I protein; FLJ10719; |
| Gene ID | 55215 |
| mRNA Refseq | NM_001113378 |
| Protein Refseq | NP_001106849 |
| MIM | 611360 |
| UniProt ID | Q9NVI1 |
| ◆ Recombinant Proteins | ||
| FANCI-12740H | Recombinant Human FANCI protein, GST-tagged | +Inquiry |
| FANCI-4675Z | Recombinant Zebrafish FANCI | +Inquiry |
| FANCI-3824C | Recombinant Chicken FANCI | +Inquiry |
| FANCI-0404H | Recombinant Human FANCI protein, His-tagged | +Inquiry |
| FANCI-4220H | Recombinant Human FANCI Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FANCI-627HCL | Recombinant Human FANCI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FANCI Products
Required fields are marked with *
My Review for All FANCI Products
Required fields are marked with *




