Recombinant Human FARP1 Protein, GST-tagged
| Cat.No. : | FARP1-3840H |
| Product Overview : | Human FARP1 full-length ORF ( NP_001001715.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein containing a FERM (4.2, exrin, radixin, moesin) domain, a Dbl homology domain, and two pleckstrin homology domains. These domains are found in guanine nucleotide exchange factors and proteins that link the cytoskeleton to the cell membrane. The encoded protein functions in neurons to promote dendritic growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
| Molecular Mass : | 40.6 kDa |
| AA Sequence : | MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FARP1 FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) [ Homo sapiens ] |
| Official Symbol | FARP1 |
| Synonyms | FARP1; FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived); FERM, RhoGEF and pleckstrin domain-containing protein 1; CDEP; MGC87400; PLEKHC2; PPP1R75; protein phosphatase 1; regulatory subunit 75; PH domain-containing family C member 2; chondrocyte-derived ezrin-like protein; protein phosphatase 1, regulatory subunit 75; pleckstrin homology domain-containing family C member 2; |
| Gene ID | 10160 |
| mRNA Refseq | NM_001001715 |
| Protein Refseq | NP_001001715 |
| MIM | 602654 |
| UniProt ID | Q9Y4F1 |
| ◆ Recombinant Proteins | ||
| FARP1-3840H | Recombinant Human FARP1 Protein, GST-tagged | +Inquiry |
| FARP1-3117M | Recombinant Mouse FARP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FARP1-5822H | Recombinant Human FARP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FARP1-5680M | Recombinant Mouse FARP1 Protein | +Inquiry |
| FARP1-4537C | Recombinant Chicken FARP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FARP1-596HCL | Recombinant Human FARP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FARP1 Products
Required fields are marked with *
My Review for All FARP1 Products
Required fields are marked with *
