Recombinant Human FARP1 Protein, GST-tagged

Cat.No. : FARP1-3840H
Product Overview : Human FARP1 full-length ORF ( NP_001001715.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing a FERM (4.2, exrin, radixin, moesin) domain, a Dbl homology domain, and two pleckstrin homology domains. These domains are found in guanine nucleotide exchange factors and proteins that link the cytoskeleton to the cell membrane. The encoded protein functions in neurons to promote dendritic growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
Molecular Mass : 40.6 kDa
AA Sequence : MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FARP1 FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) [ Homo sapiens ]
Official Symbol FARP1
Synonyms FARP1; FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived); FERM, RhoGEF and pleckstrin domain-containing protein 1; CDEP; MGC87400; PLEKHC2; PPP1R75; protein phosphatase 1; regulatory subunit 75; PH domain-containing family C member 2; chondrocyte-derived ezrin-like protein; protein phosphatase 1, regulatory subunit 75; pleckstrin homology domain-containing family C member 2;
Gene ID 10160
mRNA Refseq NM_001001715
Protein Refseq NP_001001715
MIM 602654
UniProt ID Q9Y4F1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FARP1 Products

Required fields are marked with *

My Review for All FARP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon