Recombinant Human Fas (TNFRSF6)-associated via death domain, His-tagged

Cat.No. : FADD-4351H
Product Overview : FADD produced in E.Coli is a single, non-glycosylated polypeptide chain containing 244 amino acids (1-208 a.a.) and having a molecular mass of 27.4 kDa. FADD is fused to 36 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Tag : His
Protein Length : 1-208 a.a.
Description : FADD is an adaptor protein that cooperates with a variety of cell surface receptors and mediates cell apoptotic signals. Using its C-terminal death domain, FADD is recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and consequently it take parts in the death signaling initiated by these receptors. FADD interaction with the receptors reviels the N-terminal effector domain of, which allows it to recruit caspase-8, and thus initiate the cysteine protease cascade. Knockout studies in mice furthermore propose the significance of FADD in premature T cell development. FADD plays a role in survival/proliferation and cell cycle development. FADD also takes part in cellular sublocalization, protein phosphorylation, and inhibitory molecules.
Form : The FADD protein solution contains 20mM Tris-HCl, pH-8, and 10% glycerol.
Purity : Greater than 95.0% as determined by SDS-PAGE.
Physical Appearance : Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence : MRGSHHHHHHGMASMTGGQQM GRDLYDDDDKDRWGSMDPFLVLL HSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQND LEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVI CDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN TEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWN SDAST SEAS
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Pathways : Apoptosis; Toll-like receptor signaling pathway; Apoptosis
Functions : death receptor binding; identical protein binding
Gene Name FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ]
Official Symbol FADD
Synonyms FADD; Fas (TNFRSF6)-associated via death domain; GIG3; MORT1; MGC8528; Fas-associated via death domain; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; mediator of receptor-induced toxicity; Protein FADD; Mediator of receptor induced toxicity
Gene ID 8772
mRNA Refseq NM_003824
Protein Refseq NP_003815
MIM 602457
UniProt ID Q13158
Chromosome Location 11q13.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FADD Products

Required fields are marked with *

My Review for All FADD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon