Recombinant Human Fas (TNFRSF6)-associated via death domain, His-tagged

• Cat.No.: FADD-4351H
• Product Overview: FADD produced in E.Coli is a single, non-glycosylated polypeptide chain containing 244 amino acids (1-208 a.a.) and having a molecular mass of 27.4 kDa. FADD is fused to 36 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: Human
• Tag: His
• Protein Length: 1-208 a.a.
• Description: FADD is an adaptor protein that cooperates with a variety of cell surface receptors and mediates cell apoptotic signals. Using its C-terminal death domain, FADD is recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and consequently it take parts in the death signaling initiated by these receptors. FADD interaction with the receptors reviels the N-terminal effector domain of, which allows it to recruit caspase-8, and thus initiate the cysteine protease cascade. Knockout studies in mice furthermore propose the significance of FADD in premature T cell development. FADD plays a role in survival/proliferation and cell cycle development. FADD also takes part in cellular sublocalization, protein phosphorylation, and inhibitory molecules.
• Form: The FADD protein solution contains 20mM Tris-HCl, pH-8, and 10% glycerol.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Amino acid sequence: MRGSHHHHHHGMASMTGGQQM GRDLYDDDDKDRWGSMDPFLVLL HSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQND LEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVI CDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN TEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWN SDAST SEAS
• Storage: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
• Pathways: Apoptosis; Toll-like receptor signaling pathway; Apoptosis
• Functions: death receptor binding; identical protein binding

Gene Information

• Gene Name: FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ]
• Official Symbol: FADD
• Synonyms: FADD; Fas (TNFRSF6)-associated via death domain; GIG3; MORT1; MGC8528; Fas-associated via death domain; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; mediator of receptor-induced toxicity; Protein FADD; Mediator of receptor induced toxicity
• Gene ID: 8772
• mRNA Refseq: NM_003824
• Protein Refseq: NP_003815
• MIM: 602457
• UniProt ID: Q13158
• Chromosome Location: 11q13.3