Recombinant Human FBXL7 Protein, GST-tagged
| Cat.No. : | FBXL7-3910H |
| Product Overview : | Human FBXL7 full-length ORF ( NP_036436.1, 1 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the F-box protein family which is characterized by a 42-48 amino acid motif, the F-box, which binds to the S-phase kinase-associated protein 1 (Skp1) protein. The F-box proteins constitute one of the four subunits of E3 ubiquitin protein ligases called SCFs (SKP1-Cul1-F-box), which play a role in phosphorylation-dependent ubiquitination of proteins. The F-box proteins are divided into 3 subfamilies based on the other domain in the protein: F-box proteins that also have a WD-40 domain (Fbws subfamily), F-box proteins that also have leucine-rich repeats (Fbls subfamily) and F-box proteins that contain other motifs or lack known protein-interaction domains (Fbxs subfamily). The protein encoded by this gene belongs to the Fbls subfamily. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
| Molecular Mass : | 81 kDa |
| AA Sequence : | MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBXL7 F-box and leucine-rich repeat protein 7 [ Homo sapiens ] |
| Official Symbol | FBXL7 |
| Synonyms | FBXL7; F-box and leucine-rich repeat protein 7; F-box/LRR-repeat protein 7; FBL6; FBL7; KIAA0840; F-box protein Fbl7; F-box protein FBL6/FBL7; |
| Gene ID | 23194 |
| mRNA Refseq | NM_012304 |
| Protein Refseq | NP_036436 |
| MIM | 605656 |
| UniProt ID | Q9UJT9 |
| ◆ Recombinant Proteins | ||
| FBXL7-5727M | Recombinant Mouse FBXL7 Protein | +Inquiry |
| FBXL7-3151M | Recombinant Mouse FBXL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FBXL7-3910H | Recombinant Human FBXL7 Protein, GST-tagged | +Inquiry |
| FBXL7-5005HF | Recombinant Full Length Human FBXL7 Protein, GST-tagged | +Inquiry |
| FBXL7-1656R | Recombinant Rhesus monkey FBXL7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXL7-273HCL | Recombinant Human FBXL7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL7 Products
Required fields are marked with *
My Review for All FBXL7 Products
Required fields are marked with *
