Recombinant Human FBXL7 protein, His-tagged
Cat.No. : | FBXL7-6343H |
Product Overview : | Recombinant Human FBXL7 protein(48-125 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 48-125 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | FBXL7 F-box and leucine-rich repeat protein 7 [ Homo sapiens ] |
Official Symbol | FBXL7 |
Synonyms | FBXL7; F-box and leucine-rich repeat protein 7; F-box/LRR-repeat protein 7; FBL6; FBL7; KIAA0840; F-box protein Fbl7; F-box protein FBL6/FBL7; |
Gene ID | 23194 |
mRNA Refseq | NM_012304 |
Protein Refseq | NP_036436 |
MIM | 605656 |
UniProt ID | Q9UJT9 |
◆ Recombinant Proteins | ||
FBXL7-5727M | Recombinant Mouse FBXL7 Protein | +Inquiry |
FBXL7-3151M | Recombinant Mouse FBXL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXL7-1480R | Recombinant Rhesus Macaque FBXL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXL7-6343H | Recombinant Human FBXL7 protein, His-tagged | +Inquiry |
FBXL7-3910H | Recombinant Human FBXL7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXL7-273HCL | Recombinant Human FBXL7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL7 Products
Required fields are marked with *
My Review for All FBXL7 Products
Required fields are marked with *