Recombinant Human FBXO11 Protein, GST-tagged

Cat.No. : FBXO11-3914H
Product Overview : Human FBXO11 partial ORF ( NP_079409, 744 a.a. - 843 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It can function as an arginine methyltransferase that symmetrically dimethylates arginine residues, and it acts as an adaptor protein to mediate the neddylation of p53, which leads to the suppression of p53 function. This gene is known to be down-regulated in melanocytes from patients with vitiligo, a skin disorder that results in depigmentation. Polymorphisms in this gene are associated with chronic otitis media with effusion and recurrent otitis media (COME/ROM), a hearing loss disorder, and the knockout of the homologous mouse gene results in the deaf mouse mutant Jeff (Jf), a single gene model of otitis media. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2010]
Molecular Mass : 36.74 kDa
AA Sequence : KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXO11 F-box protein 11 [ Homo sapiens ]
Official Symbol FBXO11
Synonyms FBXO11; F-box protein 11; F box only protein 11; F-box only protein 11; FBX11; PRMT9; ubiquitin protein ligase E3 component n recognin 6; UBR6; vitiligo-associated protein 1; vitiligo-associated protein VIT-1; protein arginine N-methyltransferase 9; ubiquitin protein ligase E3 component n-recognin 6; VIT1; UG063H01; FLJ12673; MGC44383;
Gene ID 80204
mRNA Refseq NM_001190274
Protein Refseq NP_001177203
MIM 607871
UniProt ID Q86XK2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXO11 Products

Required fields are marked with *

My Review for All FBXO11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon