Recombinant Human FBXO16 Protein, GST-tagged
| Cat.No. : | FBXO16-3916H | 
| Product Overview : | Human FBXO16 partial ORF ( NP_758954, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] | 
| Molecular Mass : | 36.74 kDa | 
| AA Sequence : | MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYI | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FBXO16 F-box protein 16 [ Homo sapiens ] | 
| Official Symbol | FBXO16 | 
| Synonyms | FBXO16; F-box protein 16; F box only protein 16; F-box only protein 16; FBX16; MGC125923; MGC125924; MGC125925; | 
| Gene ID | 157574 | 
| mRNA Refseq | NM_001258211 | 
| Protein Refseq | NP_001245140 | 
| MIM | 608519 | 
| UniProt ID | Q8IX29 | 
| ◆ Recombinant Proteins | ||
| FBXO16-2439Z | Recombinant Zebrafish FBXO16 | +Inquiry | 
| FBXO16-3916H | Recombinant Human FBXO16 Protein, GST-tagged | +Inquiry | 
| FBXO16-301547H | Recombinant Human FBXO16 protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FBXO16-6308HCL | Recombinant Human FBXO16 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO16 Products
Required fields are marked with *
My Review for All FBXO16 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            