Recombinant Human FBXO16 Protein, GST-tagged
Cat.No. : | FBXO16-3916H |
Product Overview : | Human FBXO16 partial ORF ( NP_758954, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO16 F-box protein 16 [ Homo sapiens ] |
Official Symbol | FBXO16 |
Synonyms | FBXO16; F-box protein 16; F box only protein 16; F-box only protein 16; FBX16; MGC125923; MGC125924; MGC125925; |
Gene ID | 157574 |
mRNA Refseq | NM_001258211 |
Protein Refseq | NP_001245140 |
MIM | 608519 |
UniProt ID | Q8IX29 |
◆ Recombinant Proteins | ||
FBXO16-2439Z | Recombinant Zebrafish FBXO16 | +Inquiry |
FBXO16-3916H | Recombinant Human FBXO16 Protein, GST-tagged | +Inquiry |
FBXO16-301547H | Recombinant Human FBXO16 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO16-6308HCL | Recombinant Human FBXO16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO16 Products
Required fields are marked with *
My Review for All FBXO16 Products
Required fields are marked with *