Recombinant Human FBXO16 protein, GST-tagged
Cat.No. : | FBXO16-301547H |
Product Overview : | Recombinant Human FBXO16 (186-287 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser186-Pro287 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FBXO16 F-box protein 16 [ Homo sapiens ] |
Official Symbol | FBXO16 |
Synonyms | FBXO16; F-box protein 16; F box only protein 16; F-box only protein 16; FBX16; MGC125923; MGC125924; MGC125925; |
Gene ID | 157574 |
mRNA Refseq | NM_001258211 |
Protein Refseq | NP_001245140 |
MIM | 608519 |
UniProt ID | Q8IX29 |
◆ Recombinant Proteins | ||
FBXO16-301547H | Recombinant Human FBXO16 protein, GST-tagged | +Inquiry |
FBXO16-3916H | Recombinant Human FBXO16 Protein, GST-tagged | +Inquiry |
FBXO16-2439Z | Recombinant Zebrafish FBXO16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO16-6308HCL | Recombinant Human FBXO16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO16 Products
Required fields are marked with *
My Review for All FBXO16 Products
Required fields are marked with *