Recombinant Human FBXO32 protein, His-tagged
Cat.No. : | FBXO32-3647H |
Product Overview : | Recombinant Human FBXO32 protein(1-216 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-216 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FBXO32 F-box protein 32 [ Homo sapiens ] |
Official Symbol | FBXO32 |
Synonyms | FBXO32; F-box protein 32; F box only protein 32; F-box only protein 32; ATROGIN1; Fbx32; MAFbx; atrogin 1; atrogin-1; muscle atrophy F-box protein; FLJ32424; MGC33610; |
Gene ID | 114907 |
mRNA Refseq | NM_001242463 |
Protein Refseq | NP_001229392 |
MIM | 606604 |
UniProt ID | Q969P5 |
◆ Recombinant Proteins | ||
FBXO32-2644C | Recombinant Chicken FBXO32 | +Inquiry |
FBXO32-237H | Recombinant Human FBXO32 Protein, His-tagged | +Inquiry |
FBXO32-7843H | Recombinant Human FBXO32 protein, GST-tagged | +Inquiry |
FBXO32-1663R | Recombinant Rhesus monkey FBXO32 Protein, His-tagged | +Inquiry |
FBXO32-1487R | Recombinant Rhesus Macaque FBXO32 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO32-6297HCL | Recombinant Human FBXO32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXO32 Products
Required fields are marked with *
My Review for All FBXO32 Products
Required fields are marked with *
0
Inquiry Basket