Recombinant Human FBXW4, His-tagged

Cat.No. : FBXW4-30064TH
Product Overview : Recombinant fragment, corresponding to amino acids 65-394 of Human SHFM3 with an N terminal His tag. Predicted mwt: 38 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 65-394 a.a.
Description : This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22.
Conjugation : HIS
Tissue specificity : Expressed in brain, kidney, lung and liver.
Form : Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWR LGRCREGILLKWRCSQMPWMQLEDDSLYISQANFILAY QFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAG GDGKIGIHKIHSTFTVKYSAHEQEVNCVDCKGGIIVSG SRDRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGV LDVMYESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEE PHDSTLYCLQTDGNHLLATGSSYYGVVRLWDRRQRACL HAFPLTSTPLSSPVYCLRLTTK
Sequence Similarities : Contains 1 F-box domain.Contains 4 WD repeats.
Gene Name FBXW4 F-box and WD repeat domain containing 4 [ Homo sapiens ]
Official Symbol FBXW4
Synonyms FBXW4; F-box and WD repeat domain containing 4; F box and WD 40 domain protein 4 , SHFM3, split hand/foot malformation (ectrodactyly) type 3; F-box/WD repeat-containing protein 4; dactylin; Fbw4;
Gene ID 6468
mRNA Refseq NM_022039
Protein Refseq NP_071322
MIM 608071
Uniprot ID P57775
Chromosome Location 10q24
Pathway Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXW4 Products

Required fields are marked with *

My Review for All FBXW4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon