Recombinant Human FBXW4, His-tagged

• Cat.No.: FBXW4-30064TH
• Product Overview: Recombinant fragment, corresponding to amino acids 65-394 of Human SHFM3 with an N terminal His tag. Predicted mwt: 38 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 65-394 a.a.
• Description: This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22.
• Conjugation: HIS
• Tissue specificity: Expressed in brain, kidney, lung and liver.
• Form: Lyophilised:Reconstitute with 87 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWR LGRCREGILLKWRCSQMPWMQLEDDSLYISQANFILAY QFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAG GDGKIGIHKIHSTFTVKYSAHEQEVNCVDCKGGIIVSG SRDRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGV LDVMYESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEE PHDSTLYCLQTDGNHLLATGSSYYGVVRLWDRRQRACL HAFPLTSTPLSSPVYCLRLTTK
• Sequence Similarities: Contains 1 F-box domain.Contains 4 WD repeats.

Gene Information

• Gene Name: FBXW4 F-box and WD repeat domain containing 4 [ Homo sapiens ]
• Official Symbol: FBXW4
• Synonyms: FBXW4; F-box and WD repeat domain containing 4; F box and WD 40 domain protein 4 , SHFM3, split hand/foot malformation (ectrodactyly) type 3; F-box/WD repeat-containing protein 4; dactylin; Fbw4
• Gene ID: 6468
• mRNA Refseq: NM_022039
• Protein Refseq: NP_071322
• MIM: 608071
• Uniprot ID: P57775
• Chromosome Location: 10q24
• Pathway: Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Protein folding, organism-specific biosystem
• Function: molecular_function