Recombinant Human FBXW7 protein, His-tagged
Cat.No. : | FBXW7-3173H |
Product Overview : | Recombinant Human FBXW7 protein(1-227 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-227 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FBXW7 F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | FBXW7 |
Synonyms | FBXW7; F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase; F box and WD repeat domain containing 7 , F box and WD 40 domain protein 7 (archipelago homolog, Drosophila); F-box/WD repeat-containing protein 7; AGO; archipelago homolog (Drosophila); CDC4; FBW7; FBX30; FBXW6; FLJ11071; SEL 10; SEL10; archipelago; F-box protein FBW7; F-box protein FBX30; F-box protein SEL-10; homolog of C elegans sel-10; F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila); FBW6; hAgo; hCdc4; FBXO30; SEL-10; FLJ16457; DKFZp686F23254; |
Gene ID | 55294 |
mRNA Refseq | NM_001013415 |
Protein Refseq | NP_001013433 |
MIM | 606278 |
UniProt ID | Q969H0 |
◆ Recombinant Proteins | ||
FBXW7-1733H | Recombinant Human FBXW7 protein, His & T7-tagged | +Inquiry |
FBXW7-2448H | Recombinant Human FBXW7 Protein, His-tagged | +Inquiry |
FBXW7-1672R | Recombinant Rhesus monkey FBXW7 Protein, His-tagged | +Inquiry |
FBXW7-2449H | Recombinant Human FBXW7 protein, His-tagged | +Inquiry |
FBXW7-3173H | Recombinant Human FBXW7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXW7-6283HCL | Recombinant Human FBXW7 293 Cell Lysate | +Inquiry |
FBXW7-6282HCL | Recombinant Human FBXW7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXW7 Products
Required fields are marked with *
My Review for All FBXW7 Products
Required fields are marked with *
0
Inquiry Basket