Recombinant Human FBXW7 protein, His-tagged

Cat.No. : FBXW7-3173H
Product Overview : Recombinant Human FBXW7 protein(1-227 aa), fused to His tag, was expressed in E. coli.
Availability July 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-227 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FBXW7 F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol FBXW7
Synonyms FBXW7; F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase; F box and WD repeat domain containing 7 , F box and WD 40 domain protein 7 (archipelago homolog, Drosophila); F-box/WD repeat-containing protein 7; AGO; archipelago homolog (Drosophila); CDC4; FBW7; FBX30; FBXW6; FLJ11071; SEL 10; SEL10; archipelago; F-box protein FBW7; F-box protein FBX30; F-box protein SEL-10; homolog of C elegans sel-10; F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila); FBW6; hAgo; hCdc4; FBXO30; SEL-10; FLJ16457; DKFZp686F23254;
Gene ID 55294
mRNA Refseq NM_001013415
Protein Refseq NP_001013433
MIM 606278
UniProt ID Q969H0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXW7 Products

Required fields are marked with *

My Review for All FBXW7 Products

Required fields are marked with *

0
cart-icon