Recombinant Human FCER1G Protein (45-86 aa), His-tagged

Cat.No. : FCER1G-1395H
Product Overview : Recombinant Human FCER1G Protein (45-86 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 45-86 aa
Description : Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 6.9 kDa
AA Sequence : RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens ]
Official Symbol FCER1G
Synonyms FCER1G; fcRgamma; fceRI gamma; FCRG;
Gene ID 2207
mRNA Refseq NM_004106
Protein Refseq NP_004097
MIM 147139
UniProt ID P30273

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCER1G Products

Required fields are marked with *

My Review for All FCER1G Products

Required fields are marked with *

0
cart-icon
0
compare icon