Recombinant Human FCER1G Protein (45-86 aa), His-tagged

• Cat.No.: FCER1G-1395H
• Product Overview: Recombinant Human FCER1G Protein (45-86 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 45-86 aa
• Description: Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 6.9 kDa
• AA Sequence: RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens ]
• Official Symbol: FCER1G
• Synonyms: FCER1G; fcRgamma; fceRI gamma; FCRG
• Gene ID: 2207
• mRNA Refseq: NM_004106
• Protein Refseq: NP_004097
• MIM: 147139
• UniProt ID: P30273