Recombinant Human FCGR1A Protein, GST-tagged
| Cat.No. : | FCGR1A-27573H |
| Product Overview : | Human FCGR1A partial ORF ( NP_000557, 16 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FCGR1A Fc fragment of IgG receptor Ia [ Homo sapiens (human) ] |
| Official Symbol | FCGR1A |
| Synonyms | FCGR1A; Fc fragment of IgG receptor Ia; CD64; FCRI; CD64A; IGFR1; high affinity immunoglobulin gamma Fc receptor I; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); Fc gamma receptor Ia; Fc-gamma RI; Fc-gamma receptor I A1; IgG Fc receptor I; fc-gamma RIA; fcgammaRIa |
| Gene ID | 2209 |
| mRNA Refseq | NM_000566 |
| Protein Refseq | NP_000557 |
| MIM | 146760 |
| UniProt ID | P12314 |
| ◆ Recombinant Proteins | ||
| FCGR1A-27573H | Recombinant Human FCGR1A Protein, GST-tagged | +Inquiry |
| FCGR1A-01C | Active Recombinant Cynomolgus Monkey FCGR1A Protein, His-tagged | +Inquiry |
| FCGR1A-381H | Recombinant Human FCGR1A protein, His-Avi-tagged | +Inquiry |
| FCGR1A-584H | Active Recombinant Human FCGR1A Protein, His-tagged | +Inquiry |
| FCGR1A-151H | Recombinant Human FCGR1A Protein, DYKDDDDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGR1-1972RCL | Recombinant Rat FCGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR1A Products
Required fields are marked with *
My Review for All FCGR1A Products
Required fields are marked with *
