Recombinant Human FCGR1A Protein, GST-tagged

Cat.No. : FCGR1A-27573H
Product Overview : Human FCGR1A partial ORF ( NP_000557, 16 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1.
Molecular Mass : 36.74 kDa
AA Sequence : QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FCGR1A Fc fragment of IgG receptor Ia [ Homo sapiens (human) ]
Official Symbol FCGR1A
Synonyms FCGR1A; Fc fragment of IgG receptor Ia; CD64; FCRI; CD64A; IGFR1; high affinity immunoglobulin gamma Fc receptor I; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); Fc gamma receptor Ia; Fc-gamma RI; Fc-gamma receptor I A1; IgG Fc receptor I; fc-gamma RIA; fcgammaRIa
Gene ID 2209
mRNA Refseq NM_000566
Protein Refseq NP_000557
MIM 146760
UniProt ID P12314

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR1A Products

Required fields are marked with *

My Review for All FCGR1A Products

Required fields are marked with *

0
cart-icon
0
compare icon