Recombinant Human FCGR1A Protein, GST-tagged
Cat.No. : | FCGR1A-27573H |
Product Overview : | Human FCGR1A partial ORF ( NP_000557, 16 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCGR1A Fc fragment of IgG receptor Ia [ Homo sapiens (human) ] |
Official Symbol | FCGR1A |
Synonyms | FCGR1A; Fc fragment of IgG receptor Ia; CD64; FCRI; CD64A; IGFR1; high affinity immunoglobulin gamma Fc receptor I; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); Fc gamma receptor Ia; Fc-gamma RI; Fc-gamma receptor I A1; IgG Fc receptor I; fc-gamma RIA; fcgammaRIa |
Gene ID | 2209 |
mRNA Refseq | NM_000566 |
Protein Refseq | NP_000557 |
MIM | 146760 |
UniProt ID | P12314 |
◆ Recombinant Proteins | ||
FCGR1A-2224H | Recombinant Human FCGR1A protein(Met1-Pro288), His-tagged | +Inquiry |
FCGR1A-584H | Active Recombinant Human FCGR1A Protein, His-tagged | +Inquiry |
FCGR1A-27573TH | Recombinant Human FCGR1A, Fc-tagged | +Inquiry |
FCGR1A-01C | Active Recombinant Cynomolgus Monkey FCGR1A Protein, His-tagged | +Inquiry |
Fcgr1a-4081R | Active Recombinant Rat Fcgr1a protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR1-1972RCL | Recombinant Rat FCGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR1A Products
Required fields are marked with *
My Review for All FCGR1A Products
Required fields are marked with *