Recombinant Human FCGR2A Protein (R167)
Cat.No. : | FCGR2A-542H |
Product Overview : | Recombinant human FCGR2A protein (R167) without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 317 |
Description : | This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized |
AA Sequence : | MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens (human) ] |
Official Symbol | FCGR2A |
Synonyms | FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032; |
Gene ID | 2212 |
mRNA Refseq | NM_001136219 |
Protein Refseq | NP_001129691 |
MIM | 146790 |
UniProt ID | P12318 |
◆ Recombinant Proteins | ||
FCGR2A-12819H | Recombinant Human FCGR2A, GST-tagged | +Inquiry |
FCGR2A-2963H | Active Recombinant Human FCGR2A, His & AVI Tagged, Biotinylated, 167 His | +Inquiry |
FCGR2A-041H | Recombinant Human FCGR2A Protein, ECD, Tag Free, Biotinylated | +Inquiry |
FCGR2A-7286H | Recombinant Human FCGR2A, His tagged | +Inquiry |
FCGR2A-5733H | Recombinant Human FCGR2A protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2A-1996HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-678HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-001HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR2A Products
Required fields are marked with *
My Review for All FCGR2A Products
Required fields are marked with *
0
Inquiry Basket