Recombinant Human FCGR3B protein(18-125aa), His-GST&Myc-tagged
| Cat.No. : | FCGR3B-309H |
| Product Overview : | Recombinant Human FCGR3B protein(O75015)(18-125aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 18-125aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIH |
| Gene Name | FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens ] |
| Official Symbol | FCGR3B |
| Synonyms | FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb; |
| Gene ID | 2215 |
| mRNA Refseq | NM_000570 |
| Protein Refseq | NP_000561 |
| MIM | 610665 |
| UniProt ID | O75015 |
| ◆ Recombinant Proteins | ||
| FCGR3B-2478H | Recombinant Human FCGR3B protein(21-100 aa), C-His-tagged | +Inquiry |
| FCGR3B-226H | Recombinant Human FCGR3B Protein, His-tagged | +Inquiry |
| FCGR3B-309H | Recombinant Human FCGR3B protein(18-125aa), His-GST&Myc-tagged | +Inquiry |
| FCGR3B-314H | Active Recombinant Human FCGR3B Protein (NA1) (Gly 17 - Ser 200), His-tagged | +Inquiry |
| FCGR3B-1209H | Recombinant Human FCGR3B Protein (Gly17-Ser200), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGR3B-001HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
| FCGR3B-3055HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR3B Products
Required fields are marked with *
My Review for All FCGR3B Products
Required fields are marked with *
