Recombinant Human FCGRT protein, His-tagged
| Cat.No. : | FCGRT-3057H |
| Product Overview : | Recombinant Human FCGRT protein(24-297 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-297 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ] |
| Official Symbol | FCGRT |
| Synonyms | FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain; |
| Gene ID | 2217 |
| mRNA Refseq | NM_001136019 |
| Protein Refseq | NP_001129491 |
| MIM | 601437 |
| UniProt ID | P55899 |
| ◆ Recombinant Proteins | ||
| FCGRT-3998H | Recombinant Human FCGRT Protein, GST-tagged | +Inquiry |
| FCGRT-5790M | Recombinant Mouse FCGRT Protein | +Inquiry |
| FCGRT-1210H | Recombinant Human FCGRT Protein, GST-tagged | +Inquiry |
| FCGRT-902H | Recombinant Human FCGRT Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCGRT-038H | Recombinant Human FCGRT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *
